Everything below concerns certificate of analysis. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Last reviewed on 2026-03-22. Where a claim depends on a specific study, the study is described rather than over-claimed.
Analytical quality control compares a stored sample against a baseline profile. Reverse-phase chromatography remains common, but stability studies may also use mass spectrometry to detect oxidation, deamidation, or truncation products. Accelerated aging at elevated temperature can reveal degradation pathways, although extrapolation to room temperature is uncertain. Forced degradation studies expose peptides to heat, light, acid, base, and oxidants to identify likely breakdown products. Documentation should record lot number, storage history, and the exact method used for each measurement.
Handling practices reduce the risk of contamination and degradation. Hygroscopic peptides should be equilibrated to room temperature before opening to prevent condensation on the powder. Weighing and reconstitution in a controlled environment limit exposure to moisture and airborne particles. Aliquotting reconstituted solutions avoids repeated freeze-thaw cycles that can cause aggregation or precipitation. When a purity specification is not met, investigation may consider synthesis byproducts, purification losses, storage conditions, and analytical variability rather than a single cause.
Impurity profiling identifies and quantifies substances that coexist with the target peptide. These include deletion sequences, truncated peptides, oxidized variants, and residual protecting groups from synthesis. Reversed-phase chromatography can separate many of these impurities, but co-elution remains a challenge for closely related species. Mass spectrometry helps assign identities to impurity peaks, and impurity limits are often set as area percentages relative to the main peak. Regulatory guidelines for research-grade peptides are less strict than those for therapeutic products, so specifications vary by supplier.
Quality control for peptides involves setting specifications for identity, purity, and counterion content. Batches are tested against these specifications before release. Purity specifications often require a minimum area percentage by high-performance liquid chromatography, such as 95% or 98%, depending on the intended application. Additional tests may include water content, acetate or trifluoroacetate content, and residual solvents. These parameters affect the net peptide content and the accuracy of subsequent laboratory experiments.
| Property | Value | Notes |
|---|---|---|
| Appearance of lyophilized powder | White to off-white solid | Visual check only; color does not measure purity. |
| Solubility | Water or aqueous buffer, sequence dependent | Some sequences need organic co-solvent. |
| Typical storage temperature | -20 °C or lower | Desiccated and protected from light. |
| Common degradation routes | Hydrolysis, oxidation, deamidation | Rates depend on sequence and environment. |
| Identity confirmation | Mass spectrometry | Mass match supports identity; purity is separate. |
Additional techniques address components that reversed-phase chromatography may not resolve. Ion-exchange chromatography separates by charge, size-exclusion chromatography detects aggregates, and capillary electrophoresis offers high separation efficiency. Water content is measured by Karl Fischer titration, residual solvents by gas chromatography, and elemental impurities by inductively coupled plasma mass spectrometry. Amino acid analysis or nitrogen determination can estimate peptide content on a mass basis. Purity is frequently reported as area percent, yet standardized comparison across laboratories remains an open question because methods and reporting practices differ.
Peptide purity testing measures how much of a sample consists of the intended peptide sequence compared with related substances, water, counterions, and residual solvents. No single analytical method captures all of these components at once. Reversed-phase high-performance liquid chromatography with ultraviolet detection is widely used because it separates peptides by hydrophobicity. The reported purity value therefore depends on the chosen method, column, mobile phase, and detection wavelength. Established practice treats purity as method-dependent rather than an absolute property of the material.
Purity and potency are related but distinct concepts in peptide testing. Purity describes the proportion of the main peptide relative to other detected substances, while potency refers to the biological or functional activity of a defined amount. A highly pure peptide can still have low potency if it is misfolded, aggregated, or chemically modified at a critical residue. Conversely, a less pure preparation may retain high activity if the impurities are inactive. Clear reporting separates these attributes and states the assay used for each.
Peptide purity specifications describe which tests define an acceptable lot and how results are reported. A certificate of analysis commonly lists a reverse-phase HPLC purity value, a mass spectrometry identity result, water content, counterion content, and residual solvent data. The specification may set a minimum area percent, such as 95% or 98%, depending on the intended use and grade. No universal threshold applies to all peptides, because sequence length, hydrophobicity, and manufacturing route influence achievable purity.
Reported purity values can differ between laboratories even for the same sample. Variations arise from column chemistry, mobile-phase composition, gradient slope, detection wavelength, injection load, and integration rules. Area percent also assumes that all species have similar response factors, which is not always true. Method validation examines specificity, linearity, accuracy, precision, limit of detection, and limit of quantitation. When comparing certificates, the method description and representative chromatogram are as important as the headline percentage.
Independent verification is used when a supplier result needs confirmation or when a material supports regulated work. A second laboratory can repeat reverse-phase HPLC and mass spectrometry on the same sample. Discrepancies may arise from different columns, gradients, detection wavelengths, or sample preparation. Moisture uptake and counterion content can lower net peptide mass without changing area percent. Documentation of methods and raw data helps distinguish analytical variation from a true quality difference.
Quality control for peptides begins with a documented specification that states the required purity, identity, and appearance. Suppliers often release research-grade material at 95% or greater by HPLC area, but this threshold is not universal. A certificate of analysis typically records the lot number, sequence, test methods, and measured values. The document allows a user to compare batches and to trace deviations. Specifications should match the intended use rather than a generic label.
Storage and handling conditions affect both peptide stability and the accuracy of later purity tests. Lyophilized powders are commonly kept desiccated at -20 °C or below, while reconstituted solutions require a defined buffer, pH, and temperature range. Repeated freeze-thaw cycles can promote aggregation, oxidation, or hydrolysis over time. Each cycle may alter the chromatogram and complicate comparison with earlier results. Stability data, when available, should guide handling intervals and solvent choice.
Actovegin is a highly filtered extract obtained from calf blood which enhances aerobic oxidation in mammals. This improves absorption of glucose and oxygen uptake in tissue, which may enhance physical performance and stamina. Local utilisation is allowed in countries like Canada and Sweden. Doctors like Hans-Wilhelm Müller-Wohlfahrt and Richard Steadman think Actovegin should be allowed in general. Others think there is not enough research, and persons from the World Anti-Doping Agency like Olivier Rabin is sceptical that it is having more than a placebo effect. Actovegin made headlines from 2009 to 2011 when Canadian sports doctor Anthony Galea was charged with drug smuggling, conspiring to lie to federal agents, unlawful possession with intent to distribute and practising medicine without a licence in the United States. Galea pleaded guilty of bringing misbranded and unapproved drugs, including Nutropin, a human growth hormone, and Actovegin, into the United States. The discipline committee for the College of Physicians and Surgeons of Ontario (CPSO) suspended Galeas license for 9 months for professional misconduct.
Eq. 3 This means that coconut oil with an abundance of medium chain fatty acids (mainly lauric acid) contain more fatty acids per unit of weight than, for example, olive oil (mainly oleic acid). Consequently, more ester saponifiable functions were present per g of coconut oil, which means more KOH is required to saponify the same amount of matter, and thus a higher SV. The calculated molecular weight (Eq. 3) is not applicable to fats and oils containing high amounts of unsaponifiable material, free fatty acids (> 0.1%), or mono- and diacylglycerols (> 0.1%).
Artificially acquired active immunity can be induced by a vaccine, a substance that contains antigen. A vaccine stimulates a primary response against the antigen without causing symptoms of the disease. The term vaccination was coined by Richard Dunning, a colleague of Edward Jenner, and adapted by Louis Pasteur for his pioneering work in vaccination. The method Pasteur used entailed treating the infectious agents for those diseases, so they lost the ability to cause serious disease. Pasteur adopted the name vaccine as a generic term in honor of Jenner's discovery, which Pasteur's work built upon. In 1807, Bavaria became the first group to require their military recruits to be vaccinated against smallpox, as the spread of smallpox was linked to combat. Subsequently, the practice of vaccination would increase with the spread of war. There are four types of traditional vaccines:
The PTB2 RNA motif is a conserved intronic RNA element identified in plant homologs of the polypyrimidine tract-binding protein 2 (PTB2) gene that has been reported as a cis-regulatory element. PTB2 is an RNA motif reported as a stem-loop structure, with the loop containing a conserved GUGUGU sequence that encompasses the 5′ splice site of a cassette exon involved in alternative splicing. The 3' side of the stem contains a long conserved pyrimidine-rich tract. The PTB2 RNA motif was identified in homologous of 93 species of Pentapetalae plants. The long conserved pyrimidine-rich tract located on the 3′ side of the PTB2 RNA motif stem suggests a role in regulation of PTB2 genes. The co-occurrence of the PTB2 RNA motif and PTB2 genes is consistent with a mechanistic link between RNA secondary structure and PTB-mediated splicing regulation. The motif has been proposed to contribute to regulation of PTB2 expression by influencing PTB1/PTB2 binding and promoting cassette exon inclusion during alternative splicing, which can lead to nonsense-mediated decay of the resulting transcript.
In 1942, Hugh DeHaven published the classic Mechanical analysis of survival in falls from heights of fifty to one hundred and fifty feet. In 1947, the American Tucker was built with the world's first padded dashboard. It also came with middle headlight that turned with the steering wheel, a front steel bulkhead, and a front safety chamber. In 1949, SAAB incorporated aircraft safety thinking into automobiles making the Saab 92 the first production SAAB car with a safety cage. Also in 1949, the Chrysler Imperial Crown was the first car to come with standard disc brakes.
Sources: en.wikipedia.org
The double helix is the dominant tertiary structure for biological DNA, and is also a possible structure for RNA. Three DNA conformations are believed to be found in nature, A-DNA, B-DNA, and Z-DNA. The "B" form described by James D. Watson and Francis Crick is believed to predominate in cells. James D. Watson and Francis Crick described this structure as a double helix with a radius of 10 Å and pitch of 34 Å, making one complete turn about its axis every 10 bp of sequence. The double helix makes one complete turn about its axis every 10.4–10.5 base pairs in solution. This frequency of twist (known as the helical pitch) depends largely on stacking forces that each base exerts on its neighbours in the chain. Double-helical RNA adopts a conformation similar to the A-form structure. Other conformations are possible; in fact, only the letters F, Q, U, V, and Y are now available to describe any new DNA structure that may appear in the future. However, most of these forms have been created synthetically and have not been observed in naturally occurring biological systems.
$40 million for the COVID-19 Genomics Network $23 million for the Vaccine and Infectious Disease Organization-International Vaccine Centre $29 million for the National Research Council of Canada $600 million through the Strategic Innovation Fund $10.3 million over 10 years, $5 million bonus to support the Canadian Immunization Research Network $114.9 million through the Canadian Institutes of Health Research A Vaccine Surveillance Reference Group (VSRG) was also established within the CITF to monitor the safety and effectiveness of COVID-19 vaccines made available in Canada. The task force was to also estimate how many Canadians were immune to the SARS-CoV-2 virus. Catherine Hankins reported that less than 1% of 10,000 samples tested positive for antibodies to SARS-CoV-2. The CITF also found that one in 100 Canadians were infected with COVID-19 during the first wave of the pandemic. Canadian Blood Services analyzed over 30,000 blood samples in total. The CITF Board was composed of doctors, infectious disease experts, and policy makers.
Cannabis Analytical Science Program (CASP) is a forum where the science of hemp and cannabis analysis can be discussed and cannabis standards and methods developed. Analytical Solutions Forum (ASF) brings global stakeholders together to identify emerging needs and technologies in scientific analysis of food and related products. === Botanical Ingredients and Dietary Supplement Integrity Program === AOAC’s Botanical Ingredient and Dietary Supplement Integrity (BIDSI) Program focuses on coordinating all future consensus-driven need for development, validation, and implementation of methods for the analysis of a wide range of botanical ingredients and dietary supplements. === Stakeholder Program on Infant Formula and Adult Nutritionals === Stakeholder Program on Infant Formula and Adult Nutritionals program (SPIFAN) develops consensus-based standards and methods to make infant formula and adult nutritionals safer for babies and adults to consume.
Any protein that can be split into two parts and reconstituted non-covalently to form a functional protein may be used in a PCA. The two fragments however have low affinity for each other and must be brought together by other interacting proteins fused to them (often called "bait" and "prey" since the bait protein can be used to identify a prey protein, see figure). The protein that produces a detectable readout is called "reporter". Usually enzymes which confer resistance to nutrient deprivation or antibiotics, such as dihydrofolate reductase or beta-lactamase respectively, or proteins that give colorimetric or fluorescent signals are used as reporters. When fluorescent proteins are reconstituted the PCA is called Bimolecular fluorescence complementation assay. The following proteins have been used in split protein PCAs:
The frog Xenopus laevis serves as an ideal model system for the study of the mechanisms of apoptosis. In fact, iodine and thyroxine also stimulate the spectacular apoptosis of the cells of the larval gills, tail and fins in amphibian's metamorphosis, and stimulate the evolution of their nervous system transforming the aquatic, vegetarian tadpole into the terrestrial, carnivorous frog. Negative regulation of apoptosis inhibits cell death signaling pathways, helping tumors to evade cell death and developing drug resistance. The ratio between anti-apoptotic (Bcl-2) and pro-apoptotic (Bax) proteins determines whether a cell lives or dies. Many families of proteins act as negative regulators categorized into either antiapoptotic factors, such as IAPs and Bcl-2 proteins or prosurvival factors like cFLIP, BNIP3, FADD, Akt, and NF-κB.
Sources: en.wikipedia.org
Arrestins block GPCR coupling to G proteins in two ways. First, arrestin binding to the cytoplasmic face of the receptor occludes the binding site for heterotrimeric G-protein, preventing its activation (desensitization). Second, arrestin links the receptor to elements of the internalization machinery, clathrin and clathrin adaptor AP2, which promotes receptor internalization via coated pits and subsequent transport to internal compartments, called endosomes. Subsequently, the receptor could be either directed to degradation compartments (lysosomes) or recycled back to the plasma membrane where it can again signal. The strength of arrestin-receptor interaction plays a role in this choice: tighter complexes tend to increase the probability of receptor degradation (Class B), whereas more transient complexes favor recycling (Class A), although this rule is far from absolute. More recently direct interactions between Gi/o family G proteins and Arrestin were discovered downstream of multiple receptors, regardless of canonical G protein coupling. These recent findings introduce a GPCR signaling mechanism distinct from canonical G protein activation and β-arrestin desensitization in which GPCRs cause the formation of Gαi:β-arrestin signaling complexes.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. In response to IFN, this protein forms a complex with STAT1 and IFN regulatory factor family protein p48 (IRF9) and form ISGF-3 (IFN-stimulated gene factor-3), in which this protein acts as a transactivator, but lacks the ability to bind DNA directly. The protein mediates innate antiviral activity. Mutations in this gene result in Immunodeficiency 44. ISGF-3 proceeds the activation of genes via the IFN-stimulated response element (ISRE). ISRE-driven genes include Ly-6C, the double-stranded RNA kinase (PKR), 2´ to 5´ oligoadenylate synthase (OAS), MX and potentially MHC class I. Transcription adaptor P300/CBP (EP300/CREBBP) has been shown to interact specifically with this protein, which is thought to be involved in the process of blocking IFN-alpha response by adenovirus. STAT2 knockout mice are unresponsive to type I IFN and extremely vulnerable to viral infection. They indicate the loss of the type I IFN autocrine loop and several defects in macrophages and T cell responses. Stat2-/- cells show differences in the biological response to IFN-α.
Nanoghosts are nanosized vesicles containing a chosen drug delivery payload manufactured from extracted leukocyte membranes with the cell cytoplasm content removed. The use of biological membranes serves to mask the particles from the immune system to reduce the likelihood of an immunogenic response, as well as to extend circulation of the particles in the blood. They are produced by homogenizing the cells to remove the cytosol, and then sonicating the empty cell membranes to create nanoghosts between 100 and 200 nm in diameter. Membranes used to make nanoghosts harvested form red blood cells have been shown to circulate for about 120 days and avoid phagocytotic cells. Neutrophil based nanoghosts retain the chemotaxis capacity of neutrophils to sites of inflammation, which encourages tumor targeting. NK based nanoghosts exhibit metastatic cancer targeting behavior. Monocyte based nanoghosts are effective at infiltrating the tumor microenvironment. Mesenchymal stem cell derived nanoghosts exhibit cancer targeting properties.
Biodiversity informatics deals with the collection and analysis of biodiversity data, such as taxonomic databases, or microbiome data. Examples of such analyses include phylogenetics, niche modelling, species richness mapping, DNA barcoding, or species identification tools. A growing area is also macro-ecology, i.e. the study of how biodiversity is connected to ecology and human impact, such as climate change. The enormous number of published literature makes it virtually impossible for individuals to read every paper, resulting in disjointed sub-fields of research. Literature analysis aims to employ computational and statistical linguistics to mine this growing library of text resources. For example: Abbreviation recognition – identify the long-form and abbreviation of biological terms Named-entity recognition – recognizing biological terms such as gene names Protein–protein interaction – identify which proteins interact with which proteins from text The area of research draws from statistics and computational linguistics.
Sources: en.wikipedia.org
Most lyophilized peptides are stored desiccated at -20 °C or lower, protected from light. Some sequences require -80 °C for long-term stability. Storage recommendations depend on sequence, moisture content, and expected duration.
Water enables hydrolysis, deamidation, and oxidation reactions that are slow or absent in dry powder. Solution pH, buffer composition, and temperature influence the rate. Freezing and thawing can also cause aggregation or precipitation.
It tracks purity, mass, and sometimes biological activity over time under defined conditions. Results indicate degradation rates and suitable storage limits. Accelerated conditions provide early signals but do not always predict room-temperature behavior.
Lyophilized peptides are typically stored at -20 °C or lower, protected from moisture and light. Solutions are often stored at -80 °C and divided into single-use aliquots. Repeated freeze-thaw cycles should be avoided.